SIST EN 50367:2020
(Main)Railway applications - Fixed installations and rolling stock - Criteria to achieve technical compatibility between pantographs and overhead contact line
Railway applications - Fixed installations and rolling stock - Criteria to achieve technical compatibility between pantographs and overhead contact line
This European Standard specifies requirements for the interaction between pantographs and overhead contact lines, to achieve to achieve free access.
NOTE These requirements are defined for a limited number of pantograph types, referred to as an 'interoperable pantograph' according to 5.3, together with the geometry and characteristics of compatible overhead contact lines.
This European Standard describes parameters and values for planned and future lines.
Annex B gives some parameters for existing lines (informative).
Bahnanwendungen - Zusammenwirken der Systeme - Technische Kriterien für das Zusammenwirken zwischen Stromabnehmer und Oberleitung für einen freien Zugang
Applications ferroviaires - Systèmes de captage de courant - Critères techniques d'interaction entre le pantographe et la ligne aérienne de contact (réalisation du libre accès)
La présente Norme européenne spécifie les exigences relatives à l'interaction entre les pantographes et les lignes aériennes de contact de manière à réaliser le libre accès.
NOTE Ces exigences sont définies pour un nombre limité de types de pantographes, désignés sous le nom « pantographe interopérable » selon le 5.3, ainsi que pour une géométrie et des caractéristiques de lignes aériennes de contact compatibles.
La présente Norme européenne décrit les paramètres et les valeurs pour les lignes en projet et futures.
L'Annexe B (informative) donne quelques paramètres concernant les lignes existantes.
Železniške naprave - Fiksni postroji in vozna sredstva - Kriteriji za doseganje tehnične združljivosti med odjemnikom toka in kontaktnim vodnikom
General Information
Relations
Buy Standard
Standards Content (Sample)
SLOVENSKI STANDARD
SIST EN 50367:2020
01-oktober-2020
Nadomešča:
SIST EN 50367:2012
SIST EN 50367:2012/A1:2017
SIST EN 50367:2012/AC:2013
Železniške naprave - Fiksni postroji in vozna sredstva - Kriteriji za doseganje
tehnične združljivosti med odjemnikom toka in kontaktnim vodnikom
Railway applications - Fixed installations and rolling stock - Criteria to achieve technical
compatibility between pantographs and overhead contact line
Bahnanwendungen - Zusammenwirken der Systeme - Technische Kriterien für das
Zusammenwirken zwischen Stromabnehmer und Oberleitung für einen freien Zugang
Applications ferroviaires - Systèmes de captage de courant - Critères techniques
d'interaction entre le pantographe et la ligne aérienne de contact (réalisation du libre
accès)
Ta slovenski standard je istoveten z: EN 50367:2020
ICS:
29.280 Električna vlečna oprema Electric traction equipment
SIST EN 50367:2020 en
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
---------------------- Page: 1 ----------------------
SIST EN 50367:2020
---------------------- Page: 2 ----------------------
SIST EN 50367:2020
EUROPEAN STANDARD EN 50367
NORME EUROPÉENNE
EUROPÄISCHE NORM
August 2020
ICS 29.280 Supersedes EN 50367:2012 and all of its amendments
and corrigenda (if any)
English Version
Railway applications - Fixed installations and rolling stock -
Criteria to achieve technical compatibility between pantographs
and overhead contact line
Applications ferroviaires - Systèmes de captage de courant Bahnanwendungen - Zusammenwirken der Systeme -
- Critères techniques d'interaction entre le pantographe et la Technische Kriterien für das Zusammenwirken zwischen
ligne aérienne de contact (réalisation du libre accès) Stromabnehmer und Oberleitung für einen freien Zugang
This European Standard was approved by CENELEC on 2020-07-27. CENELEC members are bound to comply with the CEN/CENELEC
Internal Regulations which stipulate the conditions for giving this European Standard the status of a national standard without any alteration.
Up-to-date lists and bibliographical references concerning such national standards may be obtained on application to the CEN-CENELEC
Management Centre or to any CENELEC member.
This European Standard exists in three official versions (English, French, German). A version in any other language made by translation
under the responsibility of a CENELEC member into its own language and notified to the CEN-CENELEC Management Centre has the
same status as the official versions.
CENELEC members are the national electrotechnical committees of Austria, Belgium, Bulgaria, Croatia, Cyprus, the Czech Republic,
Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the
Netherlands, Norway, Poland, Portugal, Republic of North Macedonia, Romania, Serbia, Slovakia, Slovenia, Spain, Sweden, Switzerland,
Turkey and the United Kingdom.
European Committee for Electrotechnical Standardization
Comité Européen de Normalisation Electrotechnique
Europäisches Komitee für Elektrotechnische Normung
CEN-CENELEC Management Centre: Rue de la Science 23, B-1040 Brussels
© 2020 CENELEC All rights of exploitation in any form and by any means reserved worldwide for CENELEC Members.
Ref. No. EN 50367:2020 E
---------------------- Page: 3 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
Contents Page
European foreword . 6
1 Scope . 7
2 Normative references . 7
3 Terms and definitions . 8
4 Symbols and abbreviations . 11
5 Geometry . 14
5.1 General . 14
5.2 Overhead contact line characteristics . 14
5.2.1 General . 14
5.2.2 Infrastructure gauge for free passage of pantograph . 14
5.2.3 Contact wire height . 15
5.2.4 Contact wire gradient . 15
5.2.5 Lateral deviation of contact wire. 15
5.2.6 Contact wire uplift . 18
5.2.7 Neutral sections . 18
5.2.8 Change over area between pantograph profiles . 19
5.3 Pantograph characteristics. 19
5.3.1 General . 19
5.3.2 Assessment of the pantograph head profile . 20
5.3.3 Conducting range . 23
6 Interface material . 23
6.1 General . 23
6.2 Contact wire . 24
6.3 Contact strips . 24
7 Interaction performance . 24
7.1 General . 24
7.2 Static contact forces and current capacity . 24
7.3 Dynamic behaviour and quality of current collection. 25
8 Operational requirements . 28
8.1 Requirement for pantograph . 28
8.2 Minimum and maximum distance between two operating pantographs . 28
8.2.1 General . 28
8.2.2 Design of overhead contact lines . 28
8.2.3 Formation of train with multiple pantographs - Arrangement of
pantographs . 29
9 Assessment requirements - Dynamic behaviour and quality of current collection . 29
9.1 General . 29
9.2 Overhead contact line . 30
2
---------------------- Page: 4 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
9.2.1 Assessment of overhead contact line design . 30
9.2.2 Integration of an assessed OCL into a network . 30
9.3 Pantograph . 31
9.3.1 Assessment of pantograph design . 31
9.3.2 Integration of an assessed pantograph into a vehicle . 31
Annex A (normative) Special requirements . 33
A.1 Neutral sections . 33
A.1.1 Principle of neutral section . 33
A.1.2 Long neutral section. 33
A.1.3 Short neutral section . 34
A.1.4 Split neutral section. 34
A.1.5 Arrangement of pantographs on trains . 35
A.2 Profiles for interoperable pantograph head . 36
A.2.1 Pantograph head with length of 1 600 mm . 36
A.2.2 Pantograph head with length of 1 950 mm . 37
A.3 Additional tests for DC systems at standstill . 37
A.3.1 General . 37
A.3.2 Testing conditions . 38
A.3.3 Testing method . 38
A.3.4 Test results . 40
A.4 Visualization of mean contact forces . 41
Annex B (informative) Data of existing networks . 43
B.1 General . 43
B.2 National characteristics . 43
B.3 General characteristics of pantograph head . 49
Annex C (normative) Additional tests for DC at standstill – alternative method – Test method
– Single strip configuration . 56
Annex D (informative) Specimen calculation for the permissible lateral deviation of the
contact wire according to the requirements of 5.2.5 with typical values from the German
network . 57
D.1 Calculation Values . 57
D.2 Calculation independent of type of pantograph . 59
D.2.1 Calculation of reference height . 59
D.2.2 Calculation of tolerances of track at the lower verification point . 59
D.2.3 Calculation of tolerances of track at the upper verification point . 59
D.2.4 Calculation of additional overthrow on the inside/outside of the curve for pantographs 59
D.2.5 Calculation of quasi static effect . 60
D.3 Pantograph head with length of 1600 mm . 60
D.3.1 Calculation of lateral movement of contact wire caused by forces from non-horizontal
sections of pantograph head . 60
D.3.2 Calculation of tolerances of overhead contact line . 60
3
---------------------- Page: 5 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
D.3.3 Calculation of width of mechanical kinematic pantograph gauge at minimum verification
height of the pantograph gauge in a raised position . 60
D.3.4 Calculation of width of mechanical kinematic pantograph gauge at maximum
verification height of the pantograph gauge in a raised position . 61
D.3.5 Calculation of width of mechanical kinematic pantograph gauge at reference height for
interaction between contact wire and pantograph . 61
D.3.6 permissible lateral deviation of the contact wire for stability against dewirement
according to 5.2.5.2 . 61
D.3.7 Calculation of width of mechanical kinematic gauge for serviceability of overhead
contact line at minimum verification height of the pantograph gauge in a raised
position . 62
D.3.8 Calculation of width of mechanical kinematic gauge for serviceability of overhead
contact line at maximum verification height of the pantograph gauge in a raised
position . 62
D.3.9 Calculation of width of mechanical gauge for serviceability of overhead contact line
gauge at reference height for interaction between contact wire and pantograph . 62
D.3.10 Permissible lateral deviation of the contact wire from the track centre line to
meet the serviceability limit state case according to 5.2.5.3 . 63
D.3.11 Permissible lateral deviation of the contact wire from the track centre line
according to 5.2.5.3 . 63
D.4 Pantograph head with length of 1 950 mm . 64
D.4.1 Calculation of lateral movement of contact wire caused by forces from non-horizontal
sections of pantograph head . 64
D.4.2 Calculation of tolerances of overhead contact line . 64
D.4.3 Calculation of width of mechanical kinematic pantograph gauge at minimum verification
height of the pantograph gauge in a raised position . 64
D.4.4 Calculation of width of mechanical kinematic pantograph gauge at maximum
verification height of the pantograph gauge in a raised position . 64
D.4.5 Calculation of width of mechanical kinematic pantograph gauge at reference height for
interaction between contact wire and pantograph . 65
D.4.6 permissible lateral deviation of the contact wire for stability against dewirement
according to 5.2.5.2 . 65
D.4.7 Calculation of width of mechanical kinematic gauge for serviceability of overhead
contact line at minimum verification height of the pantograph gauge in a raised
position . 65
D.4.8 Calculation of width of mechanical kinematic gauge for serviceability of overhead
contact line at maximum verification height of the pantograph gauge in a raised
position . 66
D.4.9 Calculation of width of mechanical gauge for serviceability of overhead contact line
gauge at reference height for interaction between contact wire and pantograph . 66
D.4.10 Permissible lateral deviation of the contact wire from the track centre line to
meet the serviceability limit state case according to 5.2.5.3 . 66
D.4.11 Permissible lateral deviation of the contact wire from the track centre line
according to 5.2.5.3 . 67
D.5 Illustration lateral deviation . 68
4
---------------------- Page: 6 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
Annex ZA (informative) Relationship between this European standard and the essential
requirements of EU Directive 2016/797/EU [2016 OJ L138] aimed to be covered . 72
Bibliography . 74
5
---------------------- Page: 7 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
European foreword
This document (EN 50367:2020) has been prepared by CLC/SC 9XC “Electric supply and earthing systems
for public transport equipment and ancillary apparatus (Fixed installations)”.
The following dates are fixed:
• latest date by which this document has (dop) 2021-07-27
to be implemented at national level by
publication of an identical national
standard or by endorsement
• latest date by which the national (dow) 2023-07-27
standards conflicting with this document
have to be withdrawn
This document supersedes EN 50367:2012 and all of its amendments and corrigenda (if any).
Attention is drawn to the possibility that some of the elements of this document may be the subject of patent
rights. CENELEC shall not be held responsible for identifying any or all such patent rights.
This document has been prepared under a mandate given to CENELEC by the European Commission and
the European Free Trade Association, and supports essential requirements of EU Directive(s).
For the relationship with EU Directive(s) see informative Annex ZZ, which is an integral part of this
document.
Annex B gives some parameters for existing lines (informative).
Compared with the previous version, the most significant changes in this version are:
• Update of definitions;
• Changes to 5.2.5 concerning the lateral deviation on the basis of RfS 51 from the European Union
Agency for Railways;
• Changes in 5.2.7;
• Revision of 5.3.2, including update of figures;
• Improvement of testing method for DC contact strips: 6.3, A.3;
• Addition of tunnel requirements in Clause 7;
• Revision of Table 9;
• Assessment requirements in Clause 9;
• Addition of an introduction for Annex B;
• Addition of Annex C;
• Addition of Annex D.
6
---------------------- Page: 8 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
1 Scope
This document specifies requirements for the technical compatibility between pantographs and overhead
contact lines, to achieve free access to the lines of the European railway network.
NOTE These requirements are defined for a limited number of pantograph types conforming to the requirements
in 5.3, together with the geometry and characteristics of compatible overhead contact lines.
2 Normative references
The following documents are referred to in the text in such a way that some or all of their content constitutes
requirements of this document. For dated references, only the edition cited applies. For undated references,
the latest edition of the referenced document (including any amendments) applies.
EN 15273-1:2013+A1:2016, Railway applications - Gauges - Part 1: General - Common rules for
infrastructure and rolling stock
EN 15273-2:2013+A1:2016, Railway applications - Gauges - Part 2: Rolling stock gauge
EN 15273-3:2013+A1:2016, Railway applications - Gauges - Part 3: Structure gauges
EN 50119:2020, Railway applications - Fixed installations - Electric traction overhead contact lines
EN 50125-2:2002, Railway applications - Environmental conditions for equipment - Part 2: Fixed electrical
installations
EN 50149:2012, Railway applications - Fixed installations - Electric traction - Copper and copper alloy
grooved contact wires
EN 50206-1:2010, Railway applications - Rolling stock - Pantographs: Characteristics and tests - Part 1:
Pantographs for main line vehicles
EN 50317:2012, Railway applications - Current collection systems - Requirements for and validation of
measurements of the dynamic interaction between pantograph and overhead contact line
EN 50318:2018, Railway applications - Current collection systems - Validation of simulation of the dynamic
interaction between pantograph and overhead contact line
EN 50388:2012, Railway Applications - Power supply and rolling stock - Technical criteria for the
coordination between power supply (substation) and rolling stock to achieve interoperability
EN 50405:2015, Railway applications – Current collection systems – Pantographs, testing methods for
1)
contact strips
IEC 60050-811:2017, International Electrotechnical Vocabulary (IEV) - Part 811: Electric traction
1)
This standard is impacted by EN 50405:2015/A1:2016.
7
---------------------- Page: 9 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
3 Terms and definitions
For the purposes of this document, the terms and definitions given in IEC 60050-811:2017 and the following
apply.
ISO and IEC maintain terminological databases for use in standardization at the following addresses:
• IEC Electropedia: available at http://www.electropedia.org/
• ISO Online browsing platform: available at http://www.iso.org/obp
3.1
arcing
flow of current through an air gap between a contact strip and a contact wire usually indicated by the
emission of intense light
[SOURCE: EN 50317:2012, 3.17]
3.2
pantograph dropping device
device intended to lower the pantograph automatically if it is damaged
Note 1 to entry: The damage can include the contact strip, the pantograph head and other parts of the pantograph.
[SOURCE: IEC 60050-811:2017, 811-32-22, modified – In the Note 1 to entry, “and” between “strip” and
“the pantograph” has been replaced by a comma, and the comma between “and” and “other” has been
removed]
3.3
contact force
vertical force applied by the pantograph to the contact wire(s)
Note 1 to entry: The contact force is the sum of forces of all contact points of a pantograph.
Note 2 to entry: The contact force is measured perpendicular to the contact plane.
[SOURCE: EN 50318:2018, 3.2, modified – The Note 2 to entry has been added]
3.4
contact plane
plane parallel to the base frame of the pantograph at the contact point
3.5
contact point
point of the mechanical contact between a contact strip and a contact wire
[SOURCE: EN 50317:2012, 3.2, modified – The specific domain has been added in the definition]
3.6
contact wire height
distance from the top of the rail level to the lower face of the contact wire.
Note 1 to entry: The contact wire height is measured perpendicular to the track surface.
[SOURCE: IEC 60050-811:2017, 811-33-62, modified – “or road surface for trolleybus (811-02-43) has
been removed. In the Note 1 to entry, “or road” has been removed ]
8
---------------------- Page: 10 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
3.7
pantograph head
part of the pantograph comprising the contact strips and their mountings, horns and possibly a suspension
[SOURCE: IEC 60050-811:2017, 811-32-05]
3.8
continuous pantograph head profile
pantograph head with collector strips and horns suspended in one piece
3.9
encroachment of the pantograph head
perpendicular distance from the contact plane to the highest point of the pantograph head
Note 1 to entry: Additional information is given in EN 15273-1:2013+A1:2016, Figure 46.
3.10
maximum contact wire height
maximum value of the contact wire height above rail level occurring in any possible case during the lifetime
of the overhead contact line
[SOURCE: IEC 60050-811:2017, 811-33-65]
3.11
maximum design contact wire height
maximum theoretical contact wire height not including tolerances and uplift, which the pantograph is
required to reach
3.12
maximum width of pantograph head
maximum distance measured along the axis of the track between the outer edges of the contact strips
3.13
mean contact force
F
m
statistical mean value of the contact force
Note 1 to entry: F is formed by the static and aerodynamic components of the pantograph contact force.
m
Note 2 to entry: This mean value can be assessed by simulation or measurement over a specified time or distance.
[SOURCE: EN 50317:2012, 3.5, modified – The Note 2 to entry has been added]
3.14
mechanical kinematic pantograph gauge
gauge of the pantograph head under all operating conditions
Note 1 to entry: Additional information is given in EN 15273-1:2013+A1:2016, 3.23.
3.15
minimum contact wire height
minimum value of the contact wire height above rail level occurring in any possible case during the lifetime
of the overhead contact line
[SOURCE: IEC 60050-811:2017, 811-33-64]
9
---------------------- Page: 11 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
3.16
neutral section
section of a contact line provided with a sectioning point at each end, to prevent successive electrical
sections differing in voltage, phase or frequency being connected together by the passage of pantographs
[SOURCE: IEC 60050-811:2017, 811-36-16, modified - “current collectors” has been replaced by
“pantographs”]
3.17
nominal contact wire height
nominal value of the contact wire height above rail level at a support in the normal conditions
[SOURCE: IEC 60050-811:2017; 811-33-63]
3.18
non-continuous pantograph head profile
pantograph head with collector strips separately (independently) suspended from the other parts of the
pantograph head
3.19
overhead contact line
contact line placed above the upper limit of the vehicle gauge and supplying vehicles with electric energy
through pantographs
[SOURCE: IEC 60050-811:2017, 33-02, modified – “or beside” has been removed and “roof-mounted
current collection equipment” has been replaced by “pantographs”]
3.20
percentage of arcing
NQ
proportion of driving time with arcing
[SOURCE: EN 50317:2012, 3.20]
3.21
static contact force
vertical force exerted upward by the pantograph head on the overhead contact line at standstill
[SOURCE: EN 50206-1:2010, 3.3.5, modified - “collector head” has been replaced by “pantograph” and
“system” has been removed]
3.22
transition zone
range for the transition point between non-independently suspended parts and
independently suspended parts of the pantograph head
Note 1 to entry: This concept is illustrated in Figures 1 and 2 of this document
3.23
working range of the height of pantograph
range of permissible heights of contact points in relation to the track level
10
---------------------- Page: 12 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
3.24
limit of dewirement
b
v
maximum permissible lateral deviation of contact wire position from pantograph head centre to prevent
dewirement (limit of stability for lateral interaction between contact wire and pantograph, described by the
transition point at head profile, where the angle exceeds 40°)
Note 1 to entry: Dewirement (i.e. lateral contact loss between contact wire and pantograph head) is not the only
cause of pantograph head / overhead contact line incidents. Other phenomena can lead to incidents, without exceeding
dewirement limits, as described now in this document.
3.25
working zone of pantograph head
lateral range of the contact point at the pantograph head for operation under normal conditions
(serviceability)
3.26
reference height
height of the contact point used for calculation of lateral position of contact wire at the
pantograph head
3.27
traction unit
locomotive, motor coach or train-unit
Note 1 to entry: A train can be formed with multiple traction units.
[SOURCE: IEC 60050-811:2017, 811-02-04, modified – The Note 1 to entry has been added]
4 Symbols and abbreviations
For the purposes of this document, the following symbols and abbreviations apply.
A inner distance between the contact strips on successive operational pantograph heads [m]
A’ outer distance between the contact strips on the first and last operational pantograph heads [m]
A” inner distance between the contact strips of one and the second following operational pantograph
head [m]
AC Alternating Current
b’ width of mechanical kinematic pantograph gauge at reference heig
...
SLOVENSKI STANDARD
SIST EN 50367:2020
01-oktober-2020
Nadomešča:
SIST EN 50367:2012
SIST EN 50367:2012/A1:2017
SIST EN 50367:2012/AC:2013
Železniške naprave - Sistemi za odjem toka - Tehnični kriteriji za interaktivnost
med odjemnikom toka in kontaktnim vodnikom (za doseganje prostega dostopa)
Railway applications - Current collection systems - Technical criteria for the interaction
between pantograph and overhead line (to achieve free access)
Bahnanwendungen - Zusammenwirken der Systeme - Technische Kriterien für das
Zusammenwirken zwischen Stromabnehmer und Oberleitung für einen freien Zugang
Applications ferroviaires - Systèmes de captage de courant - Critères techniques
d'interaction entre le pantographe et la ligne aérienne de contact (réalisation du libre
accès)
Ta slovenski standard je istoveten z: EN 50367:2020
ICS:
29.280 Električna vlečna oprema Electric traction equipment
SIST EN 50367:2020 en
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
---------------------- Page: 1 ----------------------
SIST EN 50367:2020
---------------------- Page: 2 ----------------------
SIST EN 50367:2020
EUROPEAN STANDARD EN 50367
NORME EUROPÉENNE
EUROPÄISCHE NORM
August 2020
ICS 29.280 Supersedes EN 50367:2012 and all of its amendments
and corrigenda (if any)
English Version
Railway applications - Fixed installations and rolling stock -
Criteria to achieve technical compatibility between pantographs
and overhead contact line
Applications ferroviaires - Systèmes de captage de courant Bahnanwendungen - Zusammenwirken der Systeme -
- Critères techniques d'interaction entre le pantographe et la Technische Kriterien für das Zusammenwirken zwischen
ligne aérienne de contact (réalisation du libre accès) Stromabnehmer und Oberleitung für einen freien Zugang
This European Standard was approved by CENELEC on 2020-07-27. CENELEC members are bound to comply with the CEN/CENELEC
Internal Regulations which stipulate the conditions for giving this European Standard the status of a national standard without any alteration.
Up-to-date lists and bibliographical references concerning such national standards may be obtained on application to the CEN-CENELEC
Management Centre or to any CENELEC member.
This European Standard exists in three official versions (English, French, German). A version in any other language made by translation
under the responsibility of a CENELEC member into its own language and notified to the CEN-CENELEC Management Centre has the
same status as the official versions.
CENELEC members are the national electrotechnical committees of Austria, Belgium, Bulgaria, Croatia, Cyprus, the Czech Republic,
Denmark, Estonia, Finland, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta, the
Netherlands, Norway, Poland, Portugal, Republic of North Macedonia, Romania, Serbia, Slovakia, Slovenia, Spain, Sweden, Switzerland,
Turkey and the United Kingdom.
European Committee for Electrotechnical Standardization
Comité Européen de Normalisation Electrotechnique
Europäisches Komitee für Elektrotechnische Normung
CEN-CENELEC Management Centre: Rue de la Science 23, B-1040 Brussels
© 2020 CENELEC All rights of exploitation in any form and by any means reserved worldwide for CENELEC Members.
Ref. No. EN 50367:2020 E
---------------------- Page: 3 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
Contents Page
European foreword . 6
1 Scope . 7
2 Normative references . 7
3 Terms and definitions . 8
4 Symbols and abbreviations . 11
5 Geometry . 14
5.1 General . 14
5.2 Overhead contact line characteristics . 14
5.2.1 General . 14
5.2.2 Infrastructure gauge for free passage of pantograph . 14
5.2.3 Contact wire height . 15
5.2.4 Contact wire gradient . 15
5.2.5 Lateral deviation of contact wire. 15
5.2.6 Contact wire uplift . 18
5.2.7 Neutral sections . 18
5.2.8 Change over area between pantograph profiles . 19
5.3 Pantograph characteristics. 19
5.3.1 General . 19
5.3.2 Assessment of the pantograph head profile . 20
5.3.3 Conducting range . 23
6 Interface material . 23
6.1 General . 23
6.2 Contact wire . 24
6.3 Contact strips . 24
7 Interaction performance . 24
7.1 General . 24
7.2 Static contact forces and current capacity . 24
7.3 Dynamic behaviour and quality of current collection. 25
8 Operational requirements . 28
8.1 Requirement for pantograph . 28
8.2 Minimum and maximum distance between two operating pantographs . 28
8.2.1 General . 28
8.2.2 Design of overhead contact lines . 28
8.2.3 Formation of train with multiple pantographs - Arrangement of
pantographs . 29
9 Assessment requirements - Dynamic behaviour and quality of current collection . 29
9.1 General . 29
9.2 Overhead contact line . 30
2
---------------------- Page: 4 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
9.2.1 Assessment of overhead contact line design . 30
9.2.2 Integration of an assessed OCL into a network . 30
9.3 Pantograph . 31
9.3.1 Assessment of pantograph design . 31
9.3.2 Integration of an assessed pantograph into a vehicle . 31
Annex A (normative) Special requirements . 33
A.1 Neutral sections . 33
A.1.1 Principle of neutral section . 33
A.1.2 Long neutral section. 33
A.1.3 Short neutral section . 34
A.1.4 Split neutral section. 34
A.1.5 Arrangement of pantographs on trains . 35
A.2 Profiles for interoperable pantograph head . 36
A.2.1 Pantograph head with length of 1 600 mm . 36
A.2.2 Pantograph head with length of 1 950 mm . 37
A.3 Additional tests for DC systems at standstill . 37
A.3.1 General . 37
A.3.2 Testing conditions . 38
A.3.3 Testing method . 38
A.3.4 Test results . 40
A.4 Visualization of mean contact forces . 41
Annex B (informative) Data of existing networks . 43
B.1 General . 43
B.2 National characteristics . 43
B.3 General characteristics of pantograph head . 49
Annex C (normative) Additional tests for DC at standstill – alternative method – Test method
– Single strip configuration . 56
Annex D (informative) Specimen calculation for the permissible lateral deviation of the
contact wire according to the requirements of 5.2.5 with typical values from the German
network . 57
D.1 Calculation Values . 57
D.2 Calculation independent of type of pantograph . 59
D.2.1 Calculation of reference height . 59
D.2.2 Calculation of tolerances of track at the lower verification point . 59
D.2.3 Calculation of tolerances of track at the upper verification point . 59
D.2.4 Calculation of additional overthrow on the inside/outside of the curve for pantographs 59
D.2.5 Calculation of quasi static effect . 60
D.3 Pantograph head with length of 1600 mm . 60
D.3.1 Calculation of lateral movement of contact wire caused by forces from non-horizontal
sections of pantograph head . 60
D.3.2 Calculation of tolerances of overhead contact line . 60
3
---------------------- Page: 5 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
D.3.3 Calculation of width of mechanical kinematic pantograph gauge at minimum verification
height of the pantograph gauge in a raised position . 60
D.3.4 Calculation of width of mechanical kinematic pantograph gauge at maximum
verification height of the pantograph gauge in a raised position . 61
D.3.5 Calculation of width of mechanical kinematic pantograph gauge at reference height for
interaction between contact wire and pantograph . 61
D.3.6 permissible lateral deviation of the contact wire for stability against dewirement
according to 5.2.5.2 . 61
D.3.7 Calculation of width of mechanical kinematic gauge for serviceability of overhead
contact line at minimum verification height of the pantograph gauge in a raised
position . 62
D.3.8 Calculation of width of mechanical kinematic gauge for serviceability of overhead
contact line at maximum verification height of the pantograph gauge in a raised
position . 62
D.3.9 Calculation of width of mechanical gauge for serviceability of overhead contact line
gauge at reference height for interaction between contact wire and pantograph . 62
D.3.10 Permissible lateral deviation of the contact wire from the track centre line to
meet the serviceability limit state case according to 5.2.5.3 . 63
D.3.11 Permissible lateral deviation of the contact wire from the track centre line
according to 5.2.5.3 . 63
D.4 Pantograph head with length of 1 950 mm . 64
D.4.1 Calculation of lateral movement of contact wire caused by forces from non-horizontal
sections of pantograph head . 64
D.4.2 Calculation of tolerances of overhead contact line . 64
D.4.3 Calculation of width of mechanical kinematic pantograph gauge at minimum verification
height of the pantograph gauge in a raised position . 64
D.4.4 Calculation of width of mechanical kinematic pantograph gauge at maximum
verification height of the pantograph gauge in a raised position . 64
D.4.5 Calculation of width of mechanical kinematic pantograph gauge at reference height for
interaction between contact wire and pantograph . 65
D.4.6 permissible lateral deviation of the contact wire for stability against dewirement
according to 5.2.5.2 . 65
D.4.7 Calculation of width of mechanical kinematic gauge for serviceability of overhead
contact line at minimum verification height of the pantograph gauge in a raised
position . 65
D.4.8 Calculation of width of mechanical kinematic gauge for serviceability of overhead
contact line at maximum verification height of the pantograph gauge in a raised
position . 66
D.4.9 Calculation of width of mechanical gauge for serviceability of overhead contact line
gauge at reference height for interaction between contact wire and pantograph . 66
D.4.10 Permissible lateral deviation of the contact wire from the track centre line to
meet the serviceability limit state case according to 5.2.5.3 . 66
D.4.11 Permissible lateral deviation of the contact wire from the track centre line
according to 5.2.5.3 . 67
D.5 Illustration lateral deviation . 68
4
---------------------- Page: 6 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
Annex ZA (informative) Relationship between this European standard and the essential
requirements of EU Directive 2016/797/EU [2016 OJ L138] aimed to be covered . 72
Bibliography . 74
5
---------------------- Page: 7 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
European foreword
This document (EN 50367:2020) has been prepared by CLC/SC 9XC “Electric supply and earthing systems
for public transport equipment and ancillary apparatus (Fixed installations)”.
The following dates are fixed:
• latest date by which this document has (dop) 2021-07-27
to be implemented at national level by
publication of an identical national
standard or by endorsement
• latest date by which the national (dow) 2023-07-27
standards conflicting with this document
have to be withdrawn
This document supersedes EN 50367:2012 and all of its amendments and corrigenda (if any).
Attention is drawn to the possibility that some of the elements of this document may be the subject of patent
rights. CENELEC shall not be held responsible for identifying any or all such patent rights.
This document has been prepared under a mandate given to CENELEC by the European Commission and
the European Free Trade Association, and supports essential requirements of EU Directive(s).
For the relationship with EU Directive(s) see informative Annex ZZ, which is an integral part of this
document.
Annex B gives some parameters for existing lines (informative).
Compared with the previous version, the most significant changes in this version are:
• Update of definitions;
• Changes to 5.2.5 concerning the lateral deviation on the basis of RfS 51 from the European Union
Agency for Railways;
• Changes in 5.2.7;
• Revision of 5.3.2, including update of figures;
• Improvement of testing method for DC contact strips: 6.3, A.3;
• Addition of tunnel requirements in Clause 7;
• Revision of Table 9;
• Assessment requirements in Clause 9;
• Addition of an introduction for Annex B;
• Addition of Annex C;
• Addition of Annex D.
6
---------------------- Page: 8 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
1 Scope
This document specifies requirements for the technical compatibility between pantographs and overhead
contact lines, to achieve free access to the lines of the European railway network.
NOTE These requirements are defined for a limited number of pantograph types conforming to the requirements
in 5.3, together with the geometry and characteristics of compatible overhead contact lines.
2 Normative references
The following documents are referred to in the text in such a way that some or all of their content constitutes
requirements of this document. For dated references, only the edition cited applies. For undated references,
the latest edition of the referenced document (including any amendments) applies.
EN 15273-1:2013+A1:2016, Railway applications - Gauges - Part 1: General - Common rules for
infrastructure and rolling stock
EN 15273-2:2013+A1:2016, Railway applications - Gauges - Part 2: Rolling stock gauge
EN 15273-3:2013+A1:2016, Railway applications - Gauges - Part 3: Structure gauges
EN 50119:2020, Railway applications - Fixed installations - Electric traction overhead contact lines
EN 50125-2:2002, Railway applications - Environmental conditions for equipment - Part 2: Fixed electrical
installations
EN 50149:2012, Railway applications - Fixed installations - Electric traction - Copper and copper alloy
grooved contact wires
EN 50206-1:2010, Railway applications - Rolling stock - Pantographs: Characteristics and tests - Part 1:
Pantographs for main line vehicles
EN 50317:2012, Railway applications - Current collection systems - Requirements for and validation of
measurements of the dynamic interaction between pantograph and overhead contact line
EN 50318:2018, Railway applications - Current collection systems - Validation of simulation of the dynamic
interaction between pantograph and overhead contact line
EN 50388:2012, Railway Applications - Power supply and rolling stock - Technical criteria for the
coordination between power supply (substation) and rolling stock to achieve interoperability
EN 50405:2015, Railway applications – Current collection systems – Pantographs, testing methods for
1)
contact strips
IEC 60050-811:2017, International Electrotechnical Vocabulary (IEV) - Part 811: Electric traction
1)
This standard is impacted by EN 50405:2015/A1:2016.
7
---------------------- Page: 9 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
3 Terms and definitions
For the purposes of this document, the terms and definitions given in IEC 60050-811:2017 and the following
apply.
ISO and IEC maintain terminological databases for use in standardization at the following addresses:
• IEC Electropedia: available at http://www.electropedia.org/
• ISO Online browsing platform: available at http://www.iso.org/obp
3.1
arcing
flow of current through an air gap between a contact strip and a contact wire usually indicated by the
emission of intense light
[SOURCE: EN 50317:2012, 3.17]
3.2
pantograph dropping device
device intended to lower the pantograph automatically if it is damaged
Note 1 to entry: The damage can include the contact strip, the pantograph head and other parts of the pantograph.
[SOURCE: IEC 60050-811:2017, 811-32-22, modified – In the Note 1 to entry, “and” between “strip” and
“the pantograph” has been replaced by a comma, and the comma between “and” and “other” has been
removed]
3.3
contact force
vertical force applied by the pantograph to the contact wire(s)
Note 1 to entry: The contact force is the sum of forces of all contact points of a pantograph.
Note 2 to entry: The contact force is measured perpendicular to the contact plane.
[SOURCE: EN 50318:2018, 3.2, modified – The Note 2 to entry has been added]
3.4
contact plane
plane parallel to the base frame of the pantograph at the contact point
3.5
contact point
point of the mechanical contact between a contact strip and a contact wire
[SOURCE: EN 50317:2012, 3.2, modified – The specific domain has been added in the definition]
3.6
contact wire height
distance from the top of the rail level to the lower face of the contact wire.
Note 1 to entry: The contact wire height is measured perpendicular to the track surface.
[SOURCE: IEC 60050-811:2017, 811-33-62, modified – “or road surface for trolleybus (811-02-43) has
been removed. In the Note 1 to entry, “or road” has been removed ]
8
---------------------- Page: 10 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
3.7
pantograph head
part of the pantograph comprising the contact strips and their mountings, horns and possibly a suspension
[SOURCE: IEC 60050-811:2017, 811-32-05]
3.8
continuous pantograph head profile
pantograph head with collector strips and horns suspended in one piece
3.9
encroachment of the pantograph head
perpendicular distance from the contact plane to the highest point of the pantograph head
Note 1 to entry: Additional information is given in EN 15273-1:2013+A1:2016, Figure 46.
3.10
maximum contact wire height
maximum value of the contact wire height above rail level occurring in any possible case during the lifetime
of the overhead contact line
[SOURCE: IEC 60050-811:2017, 811-33-65]
3.11
maximum design contact wire height
maximum theoretical contact wire height not including tolerances and uplift, which the pantograph is
required to reach
3.12
maximum width of pantograph head
maximum distance measured along the axis of the track between the outer edges of the contact strips
3.13
mean contact force
F
m
statistical mean value of the contact force
Note 1 to entry: F is formed by the static and aerodynamic components of the pantograph contact force.
m
Note 2 to entry: This mean value can be assessed by simulation or measurement over a specified time or distance.
[SOURCE: EN 50317:2012, 3.5, modified – The Note 2 to entry has been added]
3.14
mechanical kinematic pantograph gauge
gauge of the pantograph head under all operating conditions
Note 1 to entry: Additional information is given in EN 15273-1:2013+A1:2016, 3.23.
3.15
minimum contact wire height
minimum value of the contact wire height above rail level occurring in any possible case during the lifetime
of the overhead contact line
[SOURCE: IEC 60050-811:2017, 811-33-64]
9
---------------------- Page: 11 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
3.16
neutral section
section of a contact line provided with a sectioning point at each end, to prevent successive electrical
sections differing in voltage, phase or frequency being connected together by the passage of pantographs
[SOURCE: IEC 60050-811:2017, 811-36-16, modified - “current collectors” has been replaced by
“pantographs”]
3.17
nominal contact wire height
nominal value of the contact wire height above rail level at a support in the normal conditions
[SOURCE: IEC 60050-811:2017; 811-33-63]
3.18
non-continuous pantograph head profile
pantograph head with collector strips separately (independently) suspended from the other parts of the
pantograph head
3.19
overhead contact line
contact line placed above the upper limit of the vehicle gauge and supplying vehicles with electric energy
through pantographs
[SOURCE: IEC 60050-811:2017, 33-02, modified – “or beside” has been removed and “roof-mounted
current collection equipment” has been replaced by “pantographs”]
3.20
percentage of arcing
NQ
proportion of driving time with arcing
[SOURCE: EN 50317:2012, 3.20]
3.21
static contact force
vertical force exerted upward by the pantograph head on the overhead contact line at standstill
[SOURCE: EN 50206-1:2010, 3.3.5, modified - “collector head” has been replaced by “pantograph” and
“system” has been removed]
3.22
transition zone
range for the transition point between non-independently suspended parts and
independently suspended parts of the pantograph head
Note 1 to entry: This concept is illustrated in Figures 1 and 2 of this document
3.23
working range of the height of pantograph
range of permissible heights of contact points in relation to the track level
10
---------------------- Page: 12 ----------------------
SIST EN 50367:2020
EN 50367:2020 (E)
3.24
limit of dewirement
b
v
maximum permissible lateral deviation of contact wire position from pantograph head centre to prevent
dewirement (limit of stability for lateral interaction between contact wire and pantograph, described by the
transition point at head profile, where the angle exceeds 40°)
Note 1 to entry: Dewirement (i.e. lateral contact loss between contact wire and pantograph head) is not the only
cause of pantograph head / overhead contact line incidents. Other phenomena can lead to incidents, without exceeding
dewirement limits, as described now in this document.
3.25
working zone of pantograph head
lateral range of the contact point at the pantograph head for operation under normal conditions
(serviceability)
3.26
reference height
height of the contact point used for calculation of lateral position of contact wire at the
pantograph head
3.27
traction unit
locomotive, motor coach or train-unit
Note 1 to entry: A train can be formed with multiple traction units.
[SOURCE: IEC 60050-811:2017, 811-02-04, modified – The Note 1 to entry has been added]
4 Symbols and abbreviations
For the purposes of this document, the following symbols and abbreviations apply.
A inner distance between the contact strips on successive operational pantograph heads [m]
A’ outer distance between the contact strips on the first and last operational pantograph heads [m]
A” inner distance between the contact strips of one and the second following operational pantograph
head [m]
AC Alternating Current
b’ width of mechanical kinematic pantograph gauge at ref
...
SLOVENSKI STANDARD
oSIST prEN 50367:2018
01-april-2018
äHOH]QLãNHQDSUDYH6LVWHPL]DRGMHPWRND7HKQLþQLNULWHULML]DLQWHUDNWLYQRVW
PHGRGMHPQLNRPWRNDLQNRQWDNWQLPYRGQLNRP ]DGRVHJDQMHSURVWHJDGRVWRSD
Railway applications - Current collection systems - Technical criteria for the interaction
between pantograph and overhead line (to achieve free access)
Bahnanwendungen - Zusammenwirken der Systeme - Technische Kriterien für das
Zusammenwirken zwischen Stromabnehmer und Oberleitung für einen freien Zugang
Applications ferroviaires - Systèmes de captage de courant - Critères techniques
d'interaction entre le pantographe et la ligne aérienne de contact (réalisation du libre
accès)
Ta slovenski standard je istoveten z: prEN 50367:2017
ICS:
29.280 (OHNWULþQDYOHþQDRSUHPD Electric traction equipment
oSIST prEN 50367:2018 en
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
---------------------- Page: 1 ----------------------
oSIST prEN 50367:2018
---------------------- Page: 2 ----------------------
oSIST prEN 50367:2018
EUROPEAN STANDARD DRAFT
prEN 50367
NORME EUROPÉENNE
EUROPÄISCHE NORM
January 2018
ICS 29.280 Will supersede EN 50367:2012
English Version
Railway applications - Current collection systems - Technical
criteria for the interaction between pantograph and overhead line
(to achieve free access)
Applications ferroviaires - Systèmes de captage de courant Bahnanwendungen - Zusammenwirken der Systeme -
- Critères techniques d'interaction entre le pantographe et la Technische Kriterien für das Zusammenwirken zwischen
ligne aérienne de contact (réalisation du libre accès) Stromabnehmer und Oberleitung für einen freien Zugang
This draft European Standard is submitted to CENELEC members for enquiry.
Deadline for CENELEC: 2018-04-20.
It has been drawn up by CLC/SC 9XC.
If this draft becomes a European Standard, CENELEC members are bound to comply with the CEN/CENELEC Internal Regulations which
stipulate the conditions for giving this European Standard the status of a national standard without any alteration.
This draft European Standard was established by CENELEC in three official versions (English, French, German).
A version in any other language made by translation under the responsibility of a CENELEC member into its own language and notified to
the CEN-CENELEC Management Centre has the same status as the official versions.
CENELEC members are the national electrotechnical committees of Austria, Belgium, Bulgaria, Croatia, Cyprus, the Czech Republic,
Denmark, Estonia, Finland, Former Yugoslav Republic of Macedonia, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia,
Lithuania, Luxembourg, Malta, the Netherlands, Norway, Poland, Portugal, Romania, Serbia, Slovakia, Slovenia, Spain, Sweden,
Switzerland, Turkey and the United Kingdom.
Recipients of this draft are invited to submit, with their comments, notification of any relevant patent rights of which they are aware and to
provide supporting documentation.
Warning : This document is not a European Standard. It is distributed for review and comments. It is subject to change without notice and
shall not be referred to as a European Standard.
European Committee for Electrotechnical Standardization
Comité Européen de Normalisation Electrotechnique
Europäisches Komitee für Elektrotechnische Normung
CEN-CENELEC Management Centre: Rue de la Science 23, B-1040 Brussels
© 2018 CENELEC All rights of exploitation in any form and by any means reserved worldwide for CENELEC Members.
Project: 64727 Ref. No. prEN 50367:2017 E
---------------------- Page: 3 ----------------------
oSIST prEN 50367:2018
prEN 50367:2018 (E)
13 Contents Page
14 European foreword . 7
15 1 Scope . 8
16 2 Normative references . 8
17 3 Terms and definitions . 8
18 4 Symbols and abbreviations . 11
19 5 Geometry . 14
20 5.1 General . 14
21 5.2 Overhead contact line characteristics . 14
22 5.2.1 General . 14
23 5.2.2 Infrastructure gauge for free passage of pantograph . 14
24 5.2.3 Contact wire height . 15
25 5.2.4 Contact wire gradient . 15
26 5.2.5 Lateral deviation of contact wire . 15
27 5.2.6 Contact wire uplift . 17
28 5.2.7 Neutral sections . 17
29 5.2.8 Change over area between pantograph profiles . 18
30 5.3 Pantograph characteristics . 18
31 5.3.1 General . 18
32 5.3.2 Assessment of the pantograph profile . 19
33 5.3.3 Conducting range . 21
34 6 Material interfaces . 21
35 6.1 General . 21
36 6.2 Contact wire . 21
37 6.3 Contact strips . 21
38 7 Interaction performance . 22
39 7.1 General . 22
40 7.2 Current capacity . 22
41 7.3 Dynamic behaviour and quality of current collection . 23
42 8 Operational requirements . 26
43 8.1 Requirements for pantograph . 26
44 8.2 Minimum and maximum spacing between two operating pantographs . 26
45 8.2.1 General . 26
46 8.2.2 Design of overhead contact lines . 26
47 8.2.3 Formation of train with multiple pantographs - Arrangement of
48 pantographs . 27
49 9 Assessment requirements - Check of dynamic behaviour and quality of current
50 collection . 27
51 9.1 General . 27
52 9.2 Overhead contact line . 28
53 9.2.1 Assessment of overhead contact line design . 28
54 9.2.2 Integration of an assessed OCL into a network . 28
55 9.3 Pantograph . 29
56 9.3.1 Assessment of pantograph design . 29
2
---------------------- Page: 4 ----------------------
oSIST prEN 50367:2018
prEN 50367:2018 (E)
57 9.3.2 Integration of an assessed pantograph into a vehicle . 29
58 Annex A (normative) Special requirements . 30
59 A.1 Neutral sections . 30
60 A.1.1 Principle of neutral section . 30
61 A.1.2 Long neutral section . 30
62 A.1.3 Short neutral section . 31
63 A.1.4 Split neutral section . 31
64 A.1.5 Arrangement of pantograph on trains . 32
65 A.2 Profiles for interoperable pantograph head . 33
66 A.2.1 Pantograph head with length of 1 600 mm . 33
67 A.2.2 Pantograph head with length of 1 950 mm . 34
68 A.3 Additional tests for DC systems . 34
69 A.3.1 General . 34
70 A.3.2 Testing conditions . 34
71 A.3.3 Testing procedure . 35
72 A.3.4 Acceptance . 36
73 A.4 Visualization of mean contact forces . 37
74 Annex B (informative) Special national conditions . 39
75 B.1 General . 39
76 B.2 National characteristics . 39
77 B.3 General characteristics of pantograph head . 45
78 Annex C (informative) Normally used materials for contact strips . 50
79 Annex D (informative) Specimen calculation for the permissible lateral deviation of the
80 contact wire according to 5.2.5 with typical values from the German network . 51
81 D.1 Calculation Values . 51
82 D.2 Calculation independent of type of pantograph . 53
83 D.2.1 Calculation of reference height . 53
84 D.2.2 Calculation of tolerances of track at the lower verification point . 53
85 D.2.3 Calculation of tolerances of track at the upper verification point . 53
86 D.2.4 Calculation of additional overthrow on the inside/outside of the curve for pantographs 54
87 D.2.5 Calculation of quasi static effect . 54
88 D.3 Pantograph head with length of 1600 mm . 54
89 D.3.1 Calculation of lateral movement of contact wire caused by forces from non horizontal
90 sections of pantograph bow . 54
91 D.3.2 Calculation of tolerances of overhead contact line . 54
92 D.3.3 Calculation of width of mechanical kinematic pantograph gauge at minimum verification
93 height of the pantograph gauge in a raised position . 55
94 D.3.4 Calculation of width of mechanical kinematic pantograph gauge at maximum verification
95 height of the pantograph gauge in a raised position . 55
96 D.3.5 Calculation of width of mechanical kinematic pantograph gauge at reference height for
97 interaction between contact wire and pantograph . 55
3
---------------------- Page: 5 ----------------------
oSIST prEN 50367:2018
prEN 50367:2018 (E)
98 D.3.6 permissible lateral deviation of the contact wire for stability against dewirement
99 according to 5.2.5.2 . 55
100 D.3.7 Calculation of width of mechanical kinematic gauge for serviceability of overhead
101 contact line at minimum verification height of the pantograph gauge in a raised
102 position . 56
103 D.3.8 Calculation of width of mechanical kinematic gauge for serviceability of overhead
104 contact line at maximum verification height of the pantograph gauge in a raised
105 position . 56
106 D.3.9 Calculation of width of mechanical gauge for serviceability of overhead contact line
107 gauge at reference height for interaction between contact wire and pantograph . 56
108 D.3.10 Permissible lateral deviation of the contact wire from the track centre line to
109 meet the serviceability limit state case according to 5.2.5.3 . 56
110 D.3.11 Permissible lateral deviation of the contact wire from the track centre line
111 according to 5.2.5.3 . 57
112 D.4 Pantograph head with length of 1950 mm . 57
113 D.4.1 Calculation of lateral movement of contact wire caused by forces from non horizontal
114 sections of pantograph bow . 57
115 D.4.2 Calculation of tolerances of overhead contact line . 58
116 D.4.3 Calculation of width of mechanical kinematic pantograph gauge at minimum verification
117 height of the pantograph gauge in a raised position . 58
118 D.4.4 Calculation of width of mechanical kinematic pantograph gauge at maximum verification
119 height of the pantograph gauge in a raised position . 58
120 D.4.5 Calculation of width of mechanical kinematic pantograph gauge at reference height for
121 interaction between contact wire and pantograph . 58
122 D.4.6 permissible lateral deviation of the contact wire for stability against dewirement
123 according to 5.2.5.2 . 59
124 D.4.7 Calculation of width of mechanical kinematic gauge for serviceability of overhead
125 contact line at minimum verification height of the pantograph gauge in a raised
126 position . 59
127 D.4.8 Calculation of width of mechanical kinematic gauge for serviceability of overhead
128 contact line at maximum verification height of the pantograph gauge in a raised
129 position . 59
130 D.4.9 Calculation of width of mechanical gauge for serviceability of overhead contact line
131 gauge at reference height for interaction between contact wire and pantograph . 59
132 D.4.10 Permissible lateral deviation of the contact wire from the track centre line to
133 meet the serviceability limit state case according to 5.2.5.3 . 60
134 D.4.11 Permissible lateral deviation of the contact wire from the track centre line
135 according to 5.2.5.3 . 60
136 D.5 Illustration lateral deviation. 61
137 Annex ZZ (informative) Relationship between this European Standard and the Essential
138 Requirements of EU Directive 2008/57/EC . 65
139 Bibliography . 67
140 Figures
141 Figure 1 — General detail of pantograph with independently suspended collector head . 20
142 Figure 2 — Transition point – 1 600 mm and 1 950 mm pantograph head . 21
143 Figure A.1 — Principle of neutral section . 30
144 Figure A.2 — Long neutral section. 30
4
---------------------- Page: 6 ----------------------
oSIST prEN 50367:2018
prEN 50367:2018 (E)
145 Figure A.3 — Short neutral section . 31
146 Figure A.4 — Split neutral section . 31
147 Figure A.5 — Arrangement of pantograph on trains . 32
148 Figure A.6 — Profile of pantograph head with length of 1 600 mm . 33
149 Figure A.7 — Profile of pantograph head with length of 1 950 mm . 34
150 Figure A.8 — Visualization of mean contact forces AC . 37
151 Figure A.9 — Visualization of mean contact forces DC 1,5 kV . 37
152 Figure A.10 — Visualization of mean contact forces DC 3,0 kV . 38
153 Figure B.1 — Pantograph head with length of 1 450 mm . 45
154 Figure B.2 — Pantograph head with length of 1 950 mm (Type 1) . 45
155 Figure B.3 — Pantograph head with length of 1 600 mm (GB, CTRL) . 46
156 Figure B.4 — Pantograph head with length of 1 950 mm (Type 2) . 46
157 Figure B.5 — Pantograph head with length of 1 800 mm (NO, SE) . 47
158 Figure B.6 — Pantograph head with length of 1 600 mm (GB) . 48
159 Figure B.7 — Pantograph head with length of 1 950 mm (PL) . 49
160 Figure B.8 — Pantograph head with length of 1 760 mm (BE) . 49
161 Figure D 1 — visualization of limit of stability (1600 mm) . 61
162 Figure D 2 — visualization of limit of serviceability (1600 mm). 62
163 Figure D.3 — visualization of limit of stability (1950 mm) . 63
164 Figure D 4 — visualization of limit of serviceability (1950 mm). 64
165
166 Tables
167 Table 1 — Range of nominal contact wire height for AC and DC systems . 15
168 Table 2 — Maximum lateral deviation . 16
169 Table 3 — Pantograph characteristics for AC and DC systems . 19
170 Table 4 — Static contact forces . 23
171 Table 5 — Maximum current at standstill . 23
172 Table 6 — Limits for interaction performance (contact force) . 25
173 Table 7 — Values for interaction performance (arcs) . 26
174 Table 8 — Minimum OCL design distances for two pantographs . 27
175 Table B.1 — Overhead contact line characteristics for AC systems . 40
176 Table B.2 — Overhead contact line characteristics for DC systems . 40
177 Table B.3 — Rolling stock characteristics for AC systems . 41
178 Table B.4 — Rolling stock characteristics for DC systems . 42
179 Table B.5 — Interaction performance for AC systems . 43
180 Table B.6 — Interaction performance for DC systems . 44
181 Table C.1 — Contact strip material normally used . 50
182 Table D.1 — typical values of cant dependent on curve radius for line speed 200 km/h and
183 ballasted track . 52
184 Table D.2 — results of calculation for stability against dewirement for Pantograph head with
185 length of 1600 mm . 56
5
---------------------- Page: 7 ----------------------
oSIST prEN 50367:2018
prEN 50367:2018 (E)
186 Table D.3 — results of calculation for serviceability case for Pantograph head with length of
187 1600 mm . 57
188 Table D.4 — results of permissible lateral deviation of the contact wire from the track centre
189 line for Pantograph head with length of 1600 mm . 57
190 Table D.5 — results of calculation for stability against dewirement for Pantograph head with
191 length of 1950 mm . 59
192 Table D.6 — results of calculation for serviceability case for a Pantograph head with length of
193 1950 mm . 60
194 Table D.7 — results of permissible lateral deviation of the contact wire from the track centre
195 line for Pantograph head with length of 1950 mm . 60
196 Table ZZ.1 — Correspondence between this European Standard, the TSI “Locomotives and
197 Passenger Rolling Stock” (REGULATION (EU) No 1302/2014 of 18 November 2014
)
198 . 65
and Directive 2008/57/EC
199 Table ZZ.2 — Correspondence between this European Standard, the TSI “Energy”
200 (REGULATION (EU) No 1301/2014 of 18 November 2014 . 66
) and Directive 2008/57/EC
201
6
---------------------- Page: 8 ----------------------
oSIST prEN 50367:2018
prEN 50367:2018 (E)
202 European foreword
203 This document (prEN 50367:2018) has been prepared by CLC/TC 9XC “Electric supply and earthing
204 systems for public transport equipment and ancillary apparatus (Fixed installations)”.
205 This document is currently submitted to the Enquiry.
206 The following dates are proposed:
• latest date by which the existence of (doa) dor + 6 months
this document has to be announced
at national level
• latest date by which this document has to be (dop) dor + 12 months
implemented at national level by publication of an
identical national standard or by endorsement
• latest date by which the national standards (dow) dor + 36 months
conflicting with this document have to (to be confirmed or
be withdrawn modified when voting)
207 This document has been prepared under a mandate given to CENELEC by the European Commission and
208 the European Free Trade Association, and supports essential requirements of EU Directive(s).
209 For the relationship with EU Directive(s) see informative Annex ZZ, which is an integral part of this
210 document.
211 Compared with the previous version, the most significant changes in this version are:
212 • testing method for DC contact strips: 6.3, A.3;
213 • lateral deviation: changes to 5.2.5 based on RfS 51 from the European Union Agency for Railways;
214 • revision of 5.3.2, including updating of figures;
215 • addition of an introduction for Annex B;
216 • addition and revision of Table 8;
217 • addition and revision of the assessment rules in Clause 9.
7
---------------------- Page: 9 ----------------------
oSIST prEN 50367:2018
prEN 50367:2018 (E)
218 1 Scope
219 This European Standard specifies requirements for the interaction between pantographs and overhead
220 contact lines, to achieve to achieve free access.
221 NOTE These requirements are defined for a limited number of pantograph types, referred to as an 'interoperable
222 pantograph' according to 5.3, together with the geometry and characteristics of compatible overhead contact lines.
223 This European Standard describes parameters and values for planned and future lines.
224 Annex B gives some parameters for existing lines (informative).
225 2 Normative references
226 The following documents are referred to in the text in such a way that some or all of their content constitutes
227 requirements of this document. For dated references, only the edition cited applies. For undated references,
228 the latest edition of the referenced document (including any amendments) applies.
229 EN 15273-1:2013+A1:2016, Railway applications - Gauges - Part 1: General - Common rules for
230 infrastructure and rolling stock
231 EN 15273-2:2013+A1:2016, Railway applications - Gauges - Part 2: Rolling stock gauge
232 EN 15273-3:2013+A1:2016, Railway applications - Gauges - Part 3: Structure gauges
1
233 EN 50119:2009 , Railway applications - Fixed installations - Electric traction overhead contact lines
234 EN 50149:2012, Railway applications - Fixed installations - Electric traction - Copper and copper alloy
235 grooved contact wires
236 EN 50206-1:2010, Railway applications - Rolling stock - Pantographs: Characteristics and tests - Part 1:
237 Pantographs for main line vehicles
238 EN 50317:2012, Railway applications - Current collection systems - Requirements for and validation of
239 measurements of the dynamic interaction between pantograph and overhead contact line
240 EN 50318:2002, Railway applications - Current collection systems - Validation of simulation of the dynamic
241 interaction between pantograph and overhead contact line
242 EN 50388:2012, Railway applications – Power supply and rolling stock – Technical criteria for the
243 coordination between power supply (substation) and rolling stock to achieve interoperability
2
244 EN 50405:2015 , Railway applications – Current collection systems – Pantographs, testing methods for
245 carbon contact strips
246 IEC 60050-811:1991, International Electrotechnical Vocabulary – Chapter 811: Electrical traction
247 3 Terms and definitions
248 For the purposes of this document, the terms and definitions given in IEC 60050-811:1991 and the following
249 apply.
250 ISO and IEC maintain terminological databases for use in standardization at the following addresses:
...
Questions, Comments and Discussion
Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.